SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59711286|ref|YP_204062.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711286|ref|YP_204062.1|
Domain Number 1 Region: 55-241
Classification Level Classification E-value
Superfamily MetI-like 1.23e-18
Family MetI-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711286|ref|YP_204062.1|
Sequence length 254
Comment oligopeptide transport system permease OppC [Vibrio fischeri ES114]
Sequence
MLKKHLPLLLFCILILISITWQNNGETINLFNRNIAPNSLDWFGTDWLGRDVFSRTLKAL
LFSLAMGGISSVLCTVLSLCLALIGNINNTLNNIINLLVDVWSSLPHILLMIVLSVLVGG
GFEGLVIAITLSHWPKLTRLLKVEIEQLRKKPYVLHSLSFGHSKVHTYVVHITPHVLPQM
LIGMLLLYPQALVHGAGLTFLGFGIAPSTPSMGGMLSEASQYLLSGQWWLALFPGIVLVI
SSLLLISIGKSYEK
Download sequence
Identical sequences Q5E722
gi|59711286|ref|YP_204062.1| 312309.VF_0679 WP_011261407.1.76652 YP_204062.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]