SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711343|ref|YP_204119.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711343|ref|YP_204119.1|
Domain Number 1 Region: 10-182,396-482
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.55e-61
Family Bacterial dinuclear zinc exopeptidases 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|59711343|ref|YP_204119.1|
Domain Number - Region: 200-289
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0044
Family Bacterial exopeptidase dimerisation domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711343|ref|YP_204119.1|
Sequence length 484
Comment aminoacyl-histidine dipeptidase [Vibrio fischeri ES114]
Sequence
MSEISQLTPQPLWQFFDKICSIPHPSKHEEALAQYIIEWATTEGLDVRRDPTGNVFIKKP
ATPGMEDRKGVVLQAHIDMVPQKNEDTEHDFTKDPIQPYIDGEWVTAKGTTLGADNGMGM
ASCLAVLASKELKHGPLEVLLTIDEEAGMTGAFGLEAGWLEGDILLNTDSEQEGEVYMGC
AGGADGAIKLDIEREALPSGYITRQITLKGLKGGHSGCDIHTGRGNANKLLGRFLAGHAQ
ELDLRLVEFRGGSLRNAIPREAFATIAVPAENEAKLAELFTFYTNLLKDELGKVETDIVS
FNETASAEQVLTKITQSRFIATLNACPNGVIRMSDDIEGVVETSLNVGVITTDENSITIL
CLIRSLMDSGRSMVEGMLSSVAELAGAQVTFSGTYPGWKPDADSEIMHVFRDVYEGIYGN
KPNIMVIHAGLECGLFKKPYPEMDMISFGPTIKFPHSPDEKVKIDTVALYWEQMVAILEN
IPKK
Download sequence
Identical sequences Q5E6W5
VfR137 gi|59711343|ref|YP_204119.1| 312309.VF_0736 WP_011261447.1.21775 WP_011261447.1.76652 YP_204119.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]