SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711345|ref|YP_204121.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711345|ref|YP_204121.1|
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PRTase-like 6.16e-29
Family Phosphoribosyltransferases (PRTases) 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711345|ref|YP_204121.1|
Sequence length 152
Comment xanthine-guanine phosphoribosyltransferase [Vibrio fischeri ES114]
Sequence
MANKFVITWDNMQMYTRQLAEQLLPADQWKGILAVSRGGLVPAAILARELNIRHVDTVCI
SSYDHDHQRDMTVVKAMEGDGEGFIIIDDLVDSGDTAVKLREMYPKGKLVTVCAKPAGVH
LVDAYVVDIPQDTWIEQPWDMAVTYVDPIAKK
Download sequence
Identical sequences A0A1B9PL40 Q5E6W3
gi|59711345|ref|YP_204121.1| WP_005418150.1.100783 WP_005418150.1.102040 WP_005418150.1.11820 WP_005418150.1.198 WP_005418150.1.21686 WP_005418150.1.21775 WP_005418150.1.21836 WP_005418150.1.23113 WP_005418150.1.32349 WP_005418150.1.34024 WP_005418150.1.3463 WP_005418150.1.34959 WP_005418150.1.44395 WP_005418150.1.62330 WP_005418150.1.66091 WP_005418150.1.76599 WP_005418150.1.76652 WP_005418150.1.77059 WP_005418150.1.80135 WP_005418150.1.82276 WP_005418150.1.85856 WP_005418150.1.93430 WP_005418150.1.94618 WP_005418150.1.97281 YP_204121.1.56684 312309.VF_0738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]