SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711371|ref|YP_204147.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711371|ref|YP_204147.1|
Domain Number 1 Region: 86-323
Classification Level Classification E-value
Superfamily PRTase-like 3.49e-66
Family Phosphoribosylpyrophosphate synthetase-like 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59711371|ref|YP_204147.1|
Sequence length 332
Comment ribose-phosphate pyrophosphokinase [Vibrio fischeri ES114]
Sequence
MQNIKFSQFGRNPEVSTVPDMKLFAGNATPELAQRIADRLYISLGDATVDRFSDGEVAVQ
INENVRGSDVFIIQSTCAPTNDNIMELVVMIDALRRASAGRITAVIPYFGYARQDRRVRS
ARVPITAKVIADMLSNVGVDRVLTIDLHAEQIQGFFDVPVDNIFGTPVLLDDMRTRGLEN
PVVVSPDLGGVVRARATAKALGDVDIAIVDKRRPRANVSEVMNLIGDVDGRDCVIVDDMI
DTGGTLCKAAEALKERGAKRVFAYATHAVFSGSAPQNIANSVLDQVIVTDSITLSKEMAA
TGKVTELSLSRMLAEAIRRISNEESISAMFDH
Download sequence
Identical sequences B5FBW6 Q5E6T7
gi|197335710|ref|YP_002155525.1| WP_011261466.1.100783 WP_011261466.1.102040 WP_011261466.1.11820 WP_011261466.1.198 WP_011261466.1.21686 WP_011261466.1.21775 WP_011261466.1.21836 WP_011261466.1.23113 WP_011261466.1.31530 WP_011261466.1.34024 WP_011261466.1.3463 WP_011261466.1.34959 WP_011261466.1.47877 WP_011261466.1.66091 WP_011261466.1.76599 WP_011261466.1.76652 WP_011261466.1.77059 WP_011261466.1.80135 WP_011261466.1.81434 WP_011261466.1.82276 WP_011261466.1.85856 WP_011261466.1.93430 WP_011261466.1.94618 WP_011261466.1.97281 YP_204147.1.56684 gi|59711371|ref|YP_204147.1| 312309.VF_0764 388396.VFMJ11_0800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]