SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711435|ref|YP_204211.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711435|ref|YP_204211.1|
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.96e-42
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711435|ref|YP_204211.1|
Sequence length 261
Comment zinc ABC transporter membrane protein [Vibrio fischeri ES114]
Sequence
MIEFLLPALLAGLGIALLAGPLGSFVVWRKMAYFGDTLAHASLLGLSLGFLFDINLNLAL
VICCVAIAVLLVTLQKQRLVATDTLLGILAHSSLSLGLVAVSFLDNVRVDLMSYLFGDLL
AVTYDDLLYIYSGVIIILGLIFIVWKPLLSSTISEELAQVEGVNVELMRLVLMLMVGLVI
AIAMKFVGALIITSLLIIPAATARRFSRSPEQMVVFASIFGCIAVMAGLALSWHYDTPAG
PSVVVSGAAIFMLSQLKKVKG
Download sequence
Identical sequences A0A1E5AN91 B5FC31 Q5E6M3
gi|59711435|ref|YP_204211.1| 312309.VF_0828 388396.VFMJ11_0866 gi|197335967|ref|YP_002155590.1| WP_011261503.1.11820 WP_011261503.1.21775 WP_011261503.1.31530 WP_011261503.1.32349 WP_011261503.1.44395 WP_011261503.1.47877 WP_011261503.1.76599 WP_011261503.1.76652 WP_011261503.1.80135 WP_011261503.1.81434 YP_204211.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]