SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711438|ref|YP_204214.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711438|ref|YP_204214.1|
Domain Number 1 Region: 168-414
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.73e-70
Family Peptidoglycan hydrolase LytM 0.001
Further Details:      
 
Weak hits

Sequence:  gi|59711438|ref|YP_204214.1|
Domain Number - Region: 101-127
Classification Level Classification E-value
Superfamily LysM domain 0.0445
Family LysM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59711438|ref|YP_204214.1|
Sequence length 446
Comment peptidase [Vibrio fischeri ES114]
Sequence
MKYKEVLAARINSLSKRHKLVLMSLSLFTVVVFIWEPTHSISQSLSEPSRSTVTLSSENL
QTLADQNSEPVETIFDPNDPEFNAPKDELDKHINAEDIVHSHTVDAGETLGAIFNQYALS
ISDMYALLDVNKSAANMRVGVDLEWQQDEDGKLTELKIHRNIKDTDVYAWNGEKYTFTQI
EEKGEIKPVFLSGRVTSNFYNSARSAGLTPGQIQTLAKQLQWKFDFGKEARKGDRFAVEI
DKEFIDGKAVSSGDVKAVLYKNAGRDITLIKHTDGHYYDVQGRSLNRALERFPTHQRYRI
SSPFNPYRKHPITGRISPHNGTDFATPVGTSVYATGDGVVVRALHHPLAGNYIIIKHGRE
YMTRYLHLSKILVKKGQKVSMGDKIALSGNTGRSTGPHLHYELIKNGRAVNAMKVPLPQA
SPVKSDERARFKQQAKLTIEALQEQV
Download sequence
Identical sequences Q5E6M0
312309.VF_0831 gi|59711438|ref|YP_204214.1| WP_011261505.1.100783 WP_011261505.1.102040 WP_011261505.1.21836 WP_011261505.1.34959 WP_011261505.1.66091 WP_011261505.1.76652 WP_011261505.1.77059 WP_011261505.1.80135 WP_011261505.1.82276 WP_011261505.1.94618 YP_204214.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]