SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59711498|ref|YP_204274.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711498|ref|YP_204274.1|
Domain Number 1 Region: 93-277
Classification Level Classification E-value
Superfamily SIS domain 3.26e-41
Family mono-SIS domain 0.0046
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Homeodomain-like 8.06e-22
Family RpiR-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711498|ref|YP_204274.1|
Sequence length 285
Comment DNA-binding transcriptional regulator HexR [Vibrio fischeri ES114]
Sequence
MNTIEKIQNNLDNFSKSERKVAEVIMASPQTAIHSSIATLAKMADVSEPTVNRFCRRLDT
KGFPDFKLHLAQSLANGTPYVNRNVEENDGPDAYTHKIFESTMACLDVAKNSLDPMQVNR
AVDLLTQAKKISFFGLGASASVAHDAMNKFFRFNIPIACFDDIVMQRMSCINSTENDVVV
LISHTGRTKSLVEIAELAKSNGATVIAITAKDSPLEKMASLAICLDVPEDTDVYMPMASR
VVQMTVIDVLATGFTLRRGVGFRDNLKRVKEALKDSRYGKDERYQ
Download sequence
Identical sequences A0A1B9PKL8 B5FCJ0 Q5E6G0
gi|197335305|ref|YP_002155653.1| 312309.VF_0891 388396.VFMJ11_0929 WP_011261554.1.100783 WP_011261554.1.102040 WP_011261554.1.11820 WP_011261554.1.198 WP_011261554.1.21686 WP_011261554.1.21775 WP_011261554.1.21836 WP_011261554.1.23113 WP_011261554.1.31530 WP_011261554.1.32349 WP_011261554.1.34024 WP_011261554.1.3463 WP_011261554.1.34959 WP_011261554.1.44395 WP_011261554.1.47877 WP_011261554.1.66091 WP_011261554.1.76652 WP_011261554.1.77059 WP_011261554.1.80135 WP_011261554.1.82276 WP_011261554.1.85856 WP_011261554.1.93430 WP_011261554.1.94618 WP_011261554.1.97281 YP_204274.1.56684 gi|59711498|ref|YP_204274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]