SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711615|ref|YP_204391.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|59711615|ref|YP_204391.1|
Domain Number - Region: 152-223
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000989
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59711615|ref|YP_204391.1|
Sequence length 256
Comment hypothetical protein VF_1008 [Vibrio fischeri ES114]
Sequence
MEFLEPSTLIILGLVAFIAGFIDAVAGGGGMLTVPALLSIGLPPHIALGTNKLAASFASS
TAALTYFKKKLFDPHFWKTSFVATLFGATCGTLLVNYISTEWLEKGLPLIILAAAIYTIW
HPQPKADQNQLPGITPKLKTQQIIQGLSLGFYDGVAGPGTGAFWTVSSMAMYRLNILLAS
GLAKAMNFTSNFTSLVTFAILGHINWALGLTMGVCLMVGAFIGAHSAIRFGSKFIRPVFV
TVVCILAVKLALDAWF
Download sequence
Identical sequences Q5E643
gi|59711615|ref|YP_204391.1| WP_011261640.1.76652 YP_204391.1.56684 312309.VF_1008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]