SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711689|ref|YP_204465.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711689|ref|YP_204465.1|
Domain Number 1 Region: 83-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.18e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.51e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711689|ref|YP_204465.1|
Sequence length 230
Comment glutathione S-transferase [Vibrio fischeri ES114]
Sequence
MLKFYFHQTPNPMKIALYLAETELPFELMPVDTLKGEQHTKEYRAINPNGKAPAIVDDGV
RVFDSSAILLYLSETRGKLGGKAEDRAEMLSWLLFIASGLGPFSGQSVHFRHFAPEKLPY
AINRYLSEAQRHYDVLDKHLEGREYIVGDEFSIADISAWGWIDKATVVLGEEGLASYPNI
QRWFDGINSRPAVEKARNIANNVEFKSEFDEEANRSLYPQNFAKSGSAKH
Download sequence
Identical sequences Q5E5W9
gi|59711689|ref|YP_204465.1| 312309.VF_1082 WP_011261713.1.21775 WP_011261713.1.76652 WP_011261713.1.80135 YP_204465.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]