SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711765|ref|YP_204541.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711765|ref|YP_204541.1|
Domain Number 1 Region: 66-183
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.53e-34
Family Muramoyl-pentapeptide carboxypeptidase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711765|ref|YP_204541.1|
Sequence length 183
Comment hypothetical protein VF_1158 [Vibrio fischeri ES114]
Sequence
MSEFSPLRRKILLGGAATAGLSLFPSFSFASQFAETPRKLALSNLHTGEELKTEYFNGRQ
YQSAELHKLNHLCRDFRRNESIEMDKRLFDQLSAIQNVIGCDTQVQIISGYRSPATNEML
RGKSHGGVAKKSLHMLGKAMDFRLEGVPLAEVRKAALSLKAGGVGYYPGSNFVHIDTGRV
RFW
Download sequence
Identical sequences Q5E5P3
APC64205 312309.VF_1158 WP_005418984.1.23113 WP_005418984.1.62330 WP_005418984.1.76652 YP_204541.1.56684 gi|59711765|ref|YP_204541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]