SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59711772|ref|YP_204548.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711772|ref|YP_204548.1|
Domain Number 1 Region: 17-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-73
Family ABC transporter ATPase domain-like 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711772|ref|YP_204548.1|
Sequence length 241
Comment macrolide ABC transporter ATP-binding/membrane protein [Vibrio fischeri ES114]
Sequence
MNNHHKQRGGTSLIKDLVTLRDISKHYKNGTEEVRALDGVSLSIKKGEFLSILGPSGSGK
STLMNMLGCLDTPTVGKYYLDSKDVSVLSSHQLASIRNQSIGFVFQSFNLLEYASALDNV
ALPLVYGGVKIAERKQKAAALLERVGLGDRMNHKPNQLSGGQKQRVAIARALVNDPQIIL
ADEPTGALDSKSGADIEALFNELHQEGRTLIIVTHDNALAQRTKRIINIKDGKIITDEYL
A
Download sequence
Identical sequences Q5E5N6
WP_011261787.1.76652 YP_204548.1.56684 gi|59711772|ref|YP_204548.1| 312309.VF_1165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]