SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711813|ref|YP_204589.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711813|ref|YP_204589.1|
Domain Number 1 Region: 32-154
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 9.42e-28
Family Type 2 phosphatidic acid phosphatase, PAP2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711813|ref|YP_204589.1|
Sequence length 182
Comment PAP2 family phosphoesterase [Vibrio fischeri ES114]
Sequence
MKSLITAGLVFSLIASSYSAQAEEKQSGDLAADIGAVGIPVIAGSIALYKEDYDGFWMFA
KGATYTLAATQALKYTVKEERPNGEDNLSFPSGHSSSAFQGASYLQFRYGWEYGVPAYIG
ASLVGYSRVENEHHYWRDVIAGAVLATTIQYLVTDKYLDSNSVMIAPVINDDHVGIAASF
SF
Download sequence
Identical sequences Q5E5J5
APC36750 WP_011261826.1.76652 YP_204589.1.56684 gi|59711813|ref|YP_204589.1| 312309.VF_1206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]