SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711828|ref|YP_204604.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711828|ref|YP_204604.1|
Domain Number 1 Region: 7-339
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 3.27e-82
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711828|ref|YP_204604.1|
Sequence length 345
Comment hemin transport system permease HmuU [Vibrio fischeri ES114]
Sequence
MLLKYISYSKLLWLSGFSLLIIAVSSIATGPMNITLSDSFNSLIPWSTAEIPAHINLIIH
QVRLPRTILCMLVGAILAISGVVMQGLFRNPLAEPGIIGVSAGAALGAAMAIVVFSSVAQ
QFPIFMNFAAVPIFAFLGGAITTLIVYRLGTSKFGTSITVMLLAGVAISALSGAGIGYLN
FIADDQMLRDLSLWSMGSLAGAKWNDLLLAGIGLITLLVLFMKNASGLNALLLGEAEAKH
LGINVQSLKKRMIILSAVGVGITVSLSGMIGFIGLIIPHLGRMLSGPNHKTLLPLSALLG
GLLLTAADMFARVAVSPAELPVGIVTAIIGAPFFLYLLFTQRGKI
Download sequence
Identical sequences Q5E5I0
312309.VF_1221 WP_011261837.1.76652 WP_011261837.1.80135 YP_204604.1.56684 gi|59711828|ref|YP_204604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]