SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711973|ref|YP_204749.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711973|ref|YP_204749.1|
Domain Number 1 Region: 15-267
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 9.02e-70
Family FdhD/NarQ 0.0000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711973|ref|YP_204749.1|
Sequence length 273
Comment formate dehydrogenase subunit delta [Vibrio fischeri ES114]
Sequence
MSQSPKIITTGTVPKQTISVDVYDEYGEKLTKEIACEQPLTVMLNWQEVVTLMTLGARPA
ELVLGYLKNQHFVTDASLLESVIIDWETKTAAVNTKETTEHVKENLKKKTVTSGCGQGTM
YGNVMKQLENYQVPQVTINQSDLYESLEALTYHNDTYKAAGAVHGCAVCKDNKVLSFVED
VGRHNAVDTLAGELWLKQEAGDDKLFYTTGRLTSEMVIKVAQMGIPVLLSRSGVTQMGLD
LAKKFGITIIARAKGKRFQVFAGHEKINFDVKG
Download sequence
Identical sequences Q5E535
312309.VF_1366 WP_011261960.1.76652 WP_011261960.1.80135 YP_204749.1.56684 gi|59711973|ref|YP_204749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]