SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711991|ref|YP_204767.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711991|ref|YP_204767.1|
Domain Number 1 Region: 112-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.19e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.21e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711991|ref|YP_204767.1|
Sequence length 214
Comment glutathione S-transferase [Vibrio fischeri ES114]
Sequence
MTIPILYSLRQCPYAMRARLAILYAGQTVVLRDVDMMNKPKEMLSISPKGTVPVLHFEDT
VIEESVDVMLWTLTQSDPRNLLYHHDLLQLPLMLDLIQKSDSEFVQILQKYRAASRYHDD
NEMEYRDKCVEWLSDIEERLSKHTFIMGESASIVDYALLPFIRQFSRVDKKWYNIAPLPH
LRAWLVRHYNDPIFSKAMTIYPKWNRDAEPVIFG
Download sequence
Identical sequences Q5E517
gi|59711991|ref|YP_204767.1| APC61800 WP_011261975.1.76652 YP_204767.1.56684 312309.VF_1384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]