SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712132|ref|YP_204908.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712132|ref|YP_204908.1|
Domain Number 1 Region: 250-536
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.6e-53
Family D-lactate dehydrogenase 0.029
Further Details:      
 
Domain Number 2 Region: 20-192,233-275
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.32e-47
Family FAD-linked oxidases, N-terminal domain 0.0057
Further Details:      
 
Domain Number 3 Region: 553-615,645-683
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.000000314
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712132|ref|YP_204908.1|
Sequence length 1010
Comment FAD-linked oxidoreductase [Vibrio fischeri ES114]
Sequence
MLPALQFQSTIDPKVVDYLEQLSRTDFSGDIETTYSSRLAVATDNSVYQQLPQAVLLPKT
TKDVECLTTLASKEEYRTIQFSPRGGGTGTNGQSLTQGIVVDLSRHMNQVLEINIEEGWA
RVQTGLIKDQLNDALRPHGFFFSPDLSTSNRATIGGMINTDASGQGSLKYGKTSDHILAV
IAILANGECLNTELSYDQQPEKIRKVLDVTAKVCRDNRQKIEDKFPPLNRFLTGYDLKNA
LDTTNDEFDITRVLCGAEGSLAFLTEAKVNITPIPKARTLINVKYDSFDAALRNAPFMVD
ANALSVETIDSRVLNFAKQDIVWHTVSDLITDVPDKEMLGLNMVEFAGANLDEVQQQVNT
LIEKLEALQHSGTAGIIGYQVTSDVASIGKIYTMRKKAVGLLGATKGAAKPVAFAEDTCV
PPENLADFIQEFRELLDSHKLNYGMFGHVDAGVLHVRPALDMCDPEQEALMHTISDQVVA
LVSKYGGLMWGEHGKGFRSEYGPEFFGEELFTELRRVKTAFDPYNKMNPGKICTPLDSND
ELVKVSGTKRGFYDRQIPVEVRDSFNQAMECNGNGLCFNYETSSPMCPSMKVTADRRHSP
KGRAGLVREWLRQLSEQGIDPIELEKELLTKRPSIKQIIDRLKNTFNKEREYDYSHEVHE
AMMGCLACKACASQCPIKVDVPSFRSRFLNIYYSRYQRPMKDYMVANIETMLPLMAKAPK
LINGVLKQSITKSITKKTLGYVDMPLLSIPTLKERCRTNDIAEFNLKQLSELSEKERQKH
VLIVQDPFTSYYDAEVVSDFIELIQRLGLKPMLLPFKPNGKAQHIKGFLKQFASTAKTSG
EFLNQVAMLNIPMVGVDPALVLCYRDEYNEILADKRGDFAVLTVHEWLYPRLSSFDKATV
FDTRAWQLFAHCTEKTKLPNAEKEWRAIFSHFGLQLNTVPVGCCGMAGTYGHEAEKLASS
KAIYELSWKGNLASLDKERCLITGYSCRSQVKRFEGQQLKHPLQALLTNI
Download sequence
Identical sequences Q5E4M6
WP_011262103.1.76652 YP_204908.1.56684 312309.VF_1525 gi|59712132|ref|YP_204908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]