SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712148|ref|YP_204924.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712148|ref|YP_204924.1|
Domain Number 1 Region: 210-357
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 8.9e-23
Family Haloperoxidase (bromoperoxidase) 0.067
Further Details:      
 
Domain Number 2 Region: 30-142
Classification Level Classification E-value
Superfamily Nudix 3.25e-16
Family MutT-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712148|ref|YP_204924.1|
Sequence length 490
Comment phosphohydrolase [Vibrio fischeri ES114]
Sequence
MKMPLFNIFVFILSLFSMHSASANIVQPKGAVCVIGDGSHVVLVEELITGKLSLPGGTID
KERGETPQEAAEREVWEETGLVVTAKELLIEDETAAIFRCVSESDIVAFDLETINGLFRI
PSWFAPHYGIETEAVYLSEVYKIPENKYRYPGQLPLLQQWSLDTTSAENKILWVTNLVDQ
APKVHQFELDLLSSLRAKIDQLPQVVTLSVKTIFTLINETGKEGFFYFFVIIALVYFGRN
SALTLLFGIILSIVLTGLAKQGLGLPRPFVYIPQLQLTEAVGFGMPSMHSMLSVVIYGTF
YLILKRLSLPEKILKRYACIFIILIIGQSIARVWLGVHFVSDAIVGVCLGGMVFYHFSNM
QKKHGDLLYQVIGSLHFWLLLSVVISGIAFIMAYVYYLYAAAICWGVVAAIACSKPKVIN
DEKVKLIALITIVLSVMLARYGVNYLLTQVEASSLNVLVIRTIGNFTVIFGLFVYAAWLP
KVIENKFAKR
Download sequence
Identical sequences Q5E4L0
WP_011262115.1.76652 YP_204924.1.56684 312309.VF_1541 gi|59712148|ref|YP_204924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]