SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712298|ref|YP_205074.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712298|ref|YP_205074.1|
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.52e-73
Family Class II glutamine amidotransferases 0.0000000101
Further Details:      
 
Domain Number 2 Region: 250-483
Classification Level Classification E-value
Superfamily PRTase-like 3.15e-68
Family Phosphoribosyltransferases (PRTases) 0.0000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712298|ref|YP_205074.1|
Sequence length 504
Comment amidophosphoribosyltransferase [Vibrio fischeri ES114]
Sequence
MCGIVGIVGATPVNQSIYDALTVLQHRGQDAAGIITIESNRFRLRKANGLVKDVFETKHM
QRLQGNVGIGHVRYPTAGSSSASEAQPFYVNSPFGITLAHNGNLTNANEIRETLFEQERR
HVNTTSDSEVLLNIFAHHLDESKNYPLTNDDIFKTVAKVHEQIRGAYAVTAMIIGHGMVA
FRDPNGIRPLCLGKREIEGRTEYMVASESVALDAVGFDFVRDVAPGEAIYAPFEGGLYTQ
QCAHGPKLNPCIFEFVYFARPDSFIDKISVYSARVEMGKRLGEKIKREWDDLDIDVVLPI
PETSCDIALEIAQIINKPYRQGFVKNRYVGRTFIMPGQQERKKSVRRKLNAIRSEFKDKN
VLLVDDSIVRGTTSEQIIEMARDSGAKNVYMVSAAPEIRFPNVYGIDMPSANELIAHGRE
VDEICNEIGADALIFQDLSDLVDAVGCGNREIEKFETSVFNAHYVTGDVDQNYLEYLESL
RNDDAKQDNEAQNVASLDIYNEEI
Download sequence
Identical sequences Q5E460
gi|59712298|ref|YP_205074.1| WP_011262246.1.76652 YP_205074.1.56684 312309.VF_1691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]