SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712338|ref|YP_205114.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712338|ref|YP_205114.1|
Domain Number 1 Region: 91-200
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.92e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712338|ref|YP_205114.1|
Sequence length 209
Comment stringent starvation protein A [Vibrio fischeri ES114]
Sequence
MTTLYSFRRCPYAMRARLGIVQSNKTVHLREIILKSKPEAMLQASPKGTVPVLITNKGKV
IDESLDIMKWALEGSELLLSATNEMFQLIRENDDIFKSWLDKYKYADRYPEYSEIYYREQ
GELFLNKLEQRLTTSPMLFSKQYSFADLAILPFIRQFAFVDIHWFYQSKYKNLQRWLFEF
IESELFNSIMNKYPTWLDSHQEFIFPEQK
Download sequence
Identical sequences Q5E420
WP_011262281.1.76652 YP_205114.1.56684 312309.VF_1731 gi|59712338|ref|YP_205114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]