SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712485|ref|YP_205261.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712485|ref|YP_205261.1|
Domain Number 1 Region: 76-269
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.28e-49
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 3-75
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000000968
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712485|ref|YP_205261.1|
Sequence length 275
Comment chemotaxis regulator, protein-glutamate methyltransferase, CheR [Vibrio fischeri ES114]
Sequence
MTTITINEQEYRDFSRFLESQCGIVLGDSKQYLVRSRLSPLVAKFSLASLSDLLQQVISG
RNRELRVAAVDAMTTNETLWFRDGYPFTVLADKLLPELAANRRPLKIWSAASSSGQEPYS
MGMIISEIQARKPGFLPNISITATDISPSMLETCKAGVYDNLALSRGLSPERRRAFFEDA
GDGKMKINDKIKRMVNFRPQNLMDSYSLLGKFDIIFCRNVLIYFSPEMKSQVLNQMAASL
NPGGYLLLGASESLTGLTDKFEMVRCNPGIIYKLK
Download sequence
Identical sequences B5FGT2 Q5E3M3 Q8GM67
312309.VF_1878 388396.VFMJ11_2010 WP_005420407.1.198 WP_005420407.1.21686 WP_005420407.1.21775 WP_005420407.1.23113 WP_005420407.1.31530 WP_005420407.1.32349 WP_005420407.1.34024 WP_005420407.1.3463 WP_005420407.1.44395 WP_005420407.1.47877 WP_005420407.1.62330 WP_005420407.1.76599 WP_005420407.1.76652 WP_005420407.1.81434 WP_005420407.1.85856 WP_005420407.1.93430 WP_005420407.1.97281 YP_205261.1.56684 gi|59712485|ref|YP_205261.1| gi|197335651|ref|YP_002156704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]