SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712504|ref|YP_205280.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712504|ref|YP_205280.1|
Domain Number 1 Region: 18-166
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 8.72e-55
Family Glucose permease-like 0.000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712504|ref|YP_205280.1|
Sequence length 169
Comment PTS system glucose-specific transporter [Vibrio fischeri ES114]
Sequence
MGLFDKIKSAFSSESADAGAIDIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAGNKM
VAPVNGTIGKIFETNHAFSIESNDGIELFVHFGIDTVELKGEGFTRIAEEGQEVKAGDTI
IEFDLAVLEEKAKSTLTPVVISNMDEIKELTKLSGAVTVGESPVLKVTK
Download sequence
Identical sequences A0A1B9P504 B5FGV3 Q5E3K4
gi|197334947|ref|YP_002156725.1| WP_005420437.1.100783 WP_005420437.1.102040 WP_005420437.1.11820 WP_005420437.1.198 WP_005420437.1.21686 WP_005420437.1.21775 WP_005420437.1.21836 WP_005420437.1.23113 WP_005420437.1.31530 WP_005420437.1.32349 WP_005420437.1.34024 WP_005420437.1.3463 WP_005420437.1.34959 WP_005420437.1.44395 WP_005420437.1.47877 WP_005420437.1.62330 WP_005420437.1.66091 WP_005420437.1.76599 WP_005420437.1.76652 WP_005420437.1.77059 WP_005420437.1.80135 WP_005420437.1.81434 WP_005420437.1.82276 WP_005420437.1.85856 WP_005420437.1.93430 WP_005420437.1.94618 WP_005420437.1.97281 YP_205280.1.56684 gi|59712504|ref|YP_205280.1| 312309.VF_1897 388396.VFMJ11_2031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]