SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712521|ref|YP_205297.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712521|ref|YP_205297.1|
Domain Number 1 Region: 6-180,294-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.01e-65
Family Bacterial dinuclear zinc exopeptidases 0.000000353
Further Details:      
 
Domain Number 2 Region: 181-290
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.94e-31
Family Bacterial exopeptidase dimerisation domain 0.00000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712521|ref|YP_205297.1|
Sequence length 377
Comment succinyl-diaminopimelate desuccinylase [Vibrio fischeri ES114]
Sequence
MSDTPTLALAKDLLSRQSITPEDAGCQELMIKQLEALGFTIEIMVFEDTTNFWARRGNKA
PLFTFAGHTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVAEH
PNHKGSISFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTAHVGDVVKNGRR
GSLTGNLTVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNG
GTGASNVIPGTVDIMFNFRFSTESTVDELQQRVVEILDKHDLEYELDWIINGLPFLTDTG
DLLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVNVED
LEKLTDMYQEVLNNLLA
Download sequence
Identical sequences Q5E3I7
WP_011262397.1.76652 YP_205297.1.56684 312309.VF_1914 gi|59712521|ref|YP_205297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]