SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712522|ref|YP_205298.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712522|ref|YP_205298.1|
Domain Number 1 Region: 19-66,93-174
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.45e-17
Family VanY-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712522|ref|YP_205298.1|
Sequence length 222
Comment D-alanyl-D-alanine carboxypeptidase [Vibrio fischeri ES114]
Sequence
MTYQELTGQSFQHLSKLSPHRQLHHDCILPFKALSDAAHQAGFTLTIASSFRDFERQLLI
WNNKFLGIRPILDDNGHELDPSSLNDLEKIHAIMRWSALPGASRHHWGTELDVYASNTLP
EDVQLQLEPWEYNTGHQAEFSSWLNKNAPKFGFFFPYKTDKKGVAIEPWHISYKQNSNAY
MSQLTPEMLLKAWEGVDLAGKETIIKHIDTLFVRYITNIDKE
Download sequence
Identical sequences Q5E3I6
gi|59712522|ref|YP_205298.1| 312309.VF_1915 WP_011262398.1.76652 YP_205298.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]