SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712562|ref|YP_205338.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712562|ref|YP_205338.1|
Domain Number 1 Region: 211-294
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000184
Family PDZ domain 0.034
Further Details:      
 
Domain Number 2 Region: 89-186
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000112
Family MTH1368 C-terminal domain-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712562|ref|YP_205338.1|
Sequence length 452
Comment membrane-associated zinc protease [Vibrio fischeri ES114]
Sequence
MSELLWNLASFIIALGILVAVHEFGHFWVARRCGVIVEKFSIGFGKSLWSKKGKDGTEYN
ISMIPLGGYVKMLDERVDDVPEEQKERAFNNRPLWQRSAIVAAGPIANFLFAVFACWLAF
MIGVTALKPVVGQVEDGSIFSKAGITAGVELKAISGIQTSDWEAVSMAIVSHIGDDSMTV
TYSDENNIGVEVTKRLDLSQWNFDPEKDSPLLSLGFLPYRPALTLDVANVSSNSAAEKSG
LLVGDRLVSVNGNALTKWQEMVDVIQGNPSKAVDLVISREGQTVDLVLIPDSKEIADGKV
IGFAGVSPVYQEWPEGYRYEKQYGPIVAFEKALAKTGDIIDLTLTMTKKLFTGDVALNNL
SGPISIAKGAGTTAEYGLVSFLGFLALISVNLGIINLLPLPVLDGGHLLFFAIEGITRKP
VSERVQEIGYKVGTAMIMSLMAIALFNDFMRL
Download sequence
Identical sequences Q5E3E6
WP_011262429.1.76652 YP_205338.1.56684 312309.VF_1955 gi|59712562|ref|YP_205338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]