SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712568|ref|YP_205344.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712568|ref|YP_205344.1|
Domain Number 1 Region: 142-280
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 6.93e-46
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily UBA-like 1.63e-17
Family TS-N domain 0.00041
Further Details:      
 
Domain Number 3 Region: 56-137
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.87e-17
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712568|ref|YP_205344.1|
Sequence length 281
Comment elongation factor Ts [Vibrio fischeri ES114]
Sequence
MATVTAALVKELRERTGAGMMECKKALVEANADIELAIENMRKSGAAKAAKKAGNVAAEG
AIIIKEENGVAALLEVNCQTDFVAKDSNFTAFAEEVVAAAVATQATVEELQAQFEETRVA
LVAKIGENINIRRVQYVAGSALASYRHGEKIGVVVAGEGDAETLKHIAMHVAASKPEYVN
PSDVPADVVEKEKAVQVEIAMNEGKPQEIAEKMVIGRMKKFTGEVSLTGQAFIMEPKKTV
AEILKEKGASVSNFVRLEVGEGIEKAAEMSFADEVAAVQKG
Download sequence
Identical sequences Q5E3E0
312309.VF_1961 gi|59712568|ref|YP_205344.1| WP_011262434.1.23113 WP_011262434.1.76652 YP_205344.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]