SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712577|ref|YP_205353.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712577|ref|YP_205353.1|
Domain Number 1 Region: 1-345
Classification Level Classification E-value
Superfamily QueA-like 5.89e-139
Family QueA-like 0.0000000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712577|ref|YP_205353.1|
Sequence length 350
Comment S-adenosylmethionine--tRNA ribosyltransferase-isomerase [Vibrio fischeri ES114]
Sequence
MQVSDFHFELPDELIARYPQPERTASRLLQLNGNSGELNDGQFTDILDLVQAGDLLVFNN
TRVIPARMFGMKASGGKLEVLVERVLDEHSVLAHVRCSKSPKPGTMLLLGENQEHEAEMV
ARHDTLFEIRFTSDKKVLDILDEIGHMPLPPYIDRPDEDADKERYQTVYNKKPGAVAAPT
AGLHFDTEILEKMKAKGVEFAYVTLHVGAGTFQPVRVDNILEHHMHSEYAEVSQEVIDAI
NATKARGGRVVSVGTTSVRSLESAAQHALKQGTELAPFFDDTEIFIYPGYEFQVVDALVT
NFHLPESTLIMLVSAFAGYENTMKAYEQAVNNKYRFFSYGDAMFITKKTA
Download sequence
Identical sequences A0A1E5AWF5 Q5E3D1
gi|59712577|ref|YP_205353.1| 312309.VF_1970 WP_011262439.1.100783 WP_011262439.1.102040 WP_011262439.1.11820 WP_011262439.1.21775 WP_011262439.1.23113 WP_011262439.1.31530 WP_011262439.1.32349 WP_011262439.1.47877 WP_011262439.1.66091 WP_011262439.1.76599 WP_011262439.1.76652 WP_011262439.1.77059 WP_011262439.1.80135 WP_011262439.1.81434 WP_011262439.1.82276 WP_011262439.1.93430 WP_011262439.1.94618 YP_205353.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]