SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712624|ref|YP_205400.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712624|ref|YP_205400.1|
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.0000000000133
Family VanY-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712624|ref|YP_205400.1|
Sequence length 129
Comment L-alanyl-D-glutamate peptidase [Vibrio fischeri ES114]
Sequence
MNKFSKTSAARLATCHPDLIKVFTRVLELCDCSILCGHRTEEEQNTAFAEGKSQVKYPNG
KHNTLPSRAVDVAPYPIDWNDRERFSYFAGLVVGVGVSMGVAIRWGGDWDKDNELKDNNF
DDLVHFELC
Download sequence
Identical sequences Q5E384
gi|59712624|ref|YP_205400.1| WP_011262479.1.76652 YP_205400.1.56684 312309.VF_2017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]