SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712675|ref|YP_205451.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712675|ref|YP_205451.1|
Domain Number 1 Region: 170-331
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 7.85e-46
Family Peptidoglycan hydrolase LytM 0.0031
Further Details:      
 
Domain Number 2 Region: 58-103
Classification Level Classification E-value
Superfamily LysM domain 0.00000000275
Family LysM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712675|ref|YP_205451.1|
Sequence length 332
Comment lipoprotein NlpD [Vibrio fischeri ES114]
Sequence
MRKMIINLISIRLWLMAAVVSLLLSGCSMGPHRPAPVSSVNSSSSAYNGAERGSYRGSYY
TVEKGDTLYFISYVTNKDVKELIAYNELKAPYMIHPGQKIKLWGPKYIAPAYGSDGHSVT
PSNSSSSSTATAVAVVPVATNKPAPKPKPTTTSAKKTSSVQKESTKKVENSKPKEYVNSN
KTITSSKPKPVAKPKPTPKPKPKPVQQKSDKVDSWLWPTKGRIIAKFSTGDQGNKGIDIA
GQRGQDIISTAKGTVVYAGNALRGYGNLIIIKHNDDYLSAYAHNEALFVKEGQNVTAGQK
IASMGSSSTSSVRLHFEIRFRGKSVNPQRYLP
Download sequence
Identical sequences Q5E333
WP_011262535.1.23113 WP_011262535.1.76652 YP_205451.1.56684 gi|59712675|ref|YP_205451.1| 312309.VF_2068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]