SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712712|ref|YP_205488.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712712|ref|YP_205488.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-47
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.00000374
Further Details:      
 
Domain Number 2 Region: 127-198
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 1.28e-23
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712712|ref|YP_205488.1|
Sequence length 218
Comment ribose-5-phosphate isomerase A [Vibrio fischeri ES114]
Sequence
MTQDEMKKAAGWAALEYVEAGSIVGVGTGSTVNHFIDALATMKNEIKGAVSSSVASTEKL
KELGIEVFDCNDVAGLDVYVDGADEINGKNEMIKGGGAALTREKIVAAISDKFICIVDDT
KQVDVLGQFPLPVEVIPMARSYVARELVKLGGDPAYREGVITDNGNVILDVHGMKITDAK
DLEDKINALPGVVTVGLFAHRGADVLLVGAPEGVKKFD
Download sequence
Identical sequences A0A1B9PGI9 B5FAI8 Q5E2Z6
312309.VF_2105 388396.VFMJ11_2210 gi|197334434|ref|YP_002156904.1| WP_005420746.1.100783 WP_005420746.1.102040 WP_005420746.1.11820 WP_005420746.1.198 WP_005420746.1.21686 WP_005420746.1.21775 WP_005420746.1.21836 WP_005420746.1.23113 WP_005420746.1.32349 WP_005420746.1.34024 WP_005420746.1.34959 WP_005420746.1.44395 WP_005420746.1.47877 WP_005420746.1.62330 WP_005420746.1.66091 WP_005420746.1.76599 WP_005420746.1.76652 WP_005420746.1.77059 WP_005420746.1.80135 WP_005420746.1.82276 WP_005420746.1.85856 WP_005420746.1.93430 WP_005420746.1.94618 WP_005420746.1.97281 YP_205488.1.56684 gi|59712712|ref|YP_205488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]