SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712738|ref|YP_205514.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712738|ref|YP_205514.1|
Domain Number 1 Region: 144-389
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.62e-67
Family Peptidoglycan hydrolase LytM 0.00069
Further Details:      
 
Weak hits

Sequence:  gi|59712738|ref|YP_205514.1|
Domain Number - Region: 73-121
Classification Level Classification E-value
Superfamily LysM domain 0.0144
Family LysM domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712738|ref|YP_205514.1|
Sequence length 437
Comment cell wall endopeptidase [Vibrio fischeri ES114]
Sequence
MILSKLTRIPVIHRILIGLCSAGIVVTIATIPDTVAPDSGFYKLTVGQTYPIEIRKEALI
SHEKNSLNQQLSWETHTVKSGESASVLFSRIGLGYSQLLKLTSSDKEIENQLTRLRPGDK
LKFGFNQGQEIVQLIRPISKFETYRISKAGDGYIGLFEKQDIETQLNYTKATITSNFWNA
SIGAGLNPNQIMELAGIFGWDIDFALDIREGDNFKVLYEEKYVEGEYAGKGNIIAASFTN
RGDTFTAIRNDKNGNFYEPNGRAMKKAFLRSPINFRYVSSNFNPRRLHPVTGQRKAHRGT
DYVAPVGTPIWAAGDGVVDKAGYNQFNGNYVFIRHSNTYITKYLHMTKRYVRAGQRVKQG
DTIGTLGGTGRVTGPHLHYEFLVNGVHKDARTVSLPQSKSLTGKDKKEFEVVAKERLKQL
EQYGQFIVGNHPVINHE
Download sequence
Identical sequences Q5E2X0
WP_011262579.1.21836 WP_011262579.1.76652 YP_205514.1.56684 312309.VF_2131 gi|59712738|ref|YP_205514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]