SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712783|ref|YP_205559.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712783|ref|YP_205559.1|
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily PRTase-like 6.03e-56
Family Phosphoribosyltransferases (PRTases) 0.000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712783|ref|YP_205559.1|
Sequence length 176
Comment hypoxanthine phosphoribosyltransferase [Vibrio fischeri ES114]
Sequence
MKHTVEVMISEQEVNQRVKELGQQISEHYKDSEGLVMVGLLRGSFVFMADLARAIDVPMT
VDFMTASSYGNSMESTRDVRILKDLDDDIKGKDVLLVEDIIDTGNTLSKVCEILSIREPN
SITICTLLDKPSRREVEVNVDWIGFSIPDEFVVGVGIDYAQKYRNLSYIGKVVPQE
Download sequence
Identical sequences A0A1B9PEW7 B5FB12 Q5E2S5
gi|197334569|ref|YP_002156974.1| WP_005420875.1.100783 WP_005420875.1.102040 WP_005420875.1.11820 WP_005420875.1.198 WP_005420875.1.21686 WP_005420875.1.21775 WP_005420875.1.21836 WP_005420875.1.23113 WP_005420875.1.31530 WP_005420875.1.34024 WP_005420875.1.3463 WP_005420875.1.34959 WP_005420875.1.44395 WP_005420875.1.47877 WP_005420875.1.62330 WP_005420875.1.66091 WP_005420875.1.76599 WP_005420875.1.76652 WP_005420875.1.77059 WP_005420875.1.81434 WP_005420875.1.82276 WP_005420875.1.85856 WP_005420875.1.93430 WP_005420875.1.94618 WP_005420875.1.97281 YP_205559.1.56684 312309.VF_2176 388396.VFMJ11_2290 gi|59712783|ref|YP_205559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]