SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712807|ref|YP_205583.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712807|ref|YP_205583.1|
Domain Number 1 Region: 108-325
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.16e-74
Family MurCDEF 0.000000151
Further Details:      
 
Domain Number 2 Region: 326-473
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.83e-47
Family MurCDEF C-terminal domain 0.0000016
Further Details:      
 
Domain Number 3 Region: 25-109
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 9.55e-28
Family MurCD N-terminal domain 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712807|ref|YP_205583.1|
Sequence length 487
Comment UDP-N-acetylmuramate--L-alanine ligase [Vibrio fischeri ES114]
Sequence
MTKEQKLQLAEIRTMIPEMRRVECIHFVGIGGAGMSGIAEVLLNEGYHISGSDMAENTVT
VRLAQKGAEIFFGHQASNVAKASVVVVSTAIDPSNPEIVAAKENRIPVIRRAEMLAELMR
YRHGIAVAGTHGKTTTTALTTQIYSEAGLDPTFVNGGLVKNAGTNARLGSSRFLIAEADE
SDASFLHLQPMVSIVTNIEADHMDTYGGDFETLKQTFIDFLHNLPFYGQAVMCVDDPVVR
ELLPQVSRQVITYGFSDDADVRLINYRQVGQQSFFTVQRKDRTDLDIVLNIPGKHNALNA
TAAIAVATEEDVEDEAILTALLNFEGAGRRFDQLGEFETGNGSAMLVDDYGHHPTEVDVT
IKAARAGWAEKRLVMIFQPHRYSRTRDLYDDFANVLDNVDVLIMLDVYSAGETPIAGADG
RALCRTIRGRGKIDPVFVPTIEALPPVLANIIQEGDLILTQGAGDVGKLAKQLASMELNI
ETMKKLG
Download sequence
Identical sequences Q5E2Q1
WP_011262631.1.76652 YP_205583.1.56684 gi|59712807|ref|YP_205583.1| 312309.VF_2200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]