SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712810|ref|YP_205586.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712810|ref|YP_205586.1|
Domain Number 1 Region: 62-261
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.83e-53
Family MurCDEF 0.00000221
Further Details:      
 
Domain Number 2 Region: 263-399
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.48e-44
Family MurCDEF C-terminal domain 0.0000139
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 0.0000000589
Family MurCD N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712810|ref|YP_205586.1|
Sequence length 404
Comment UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio fischeri ES114]
Sequence
MIDTRDTPPGHDQLPENVELHSGGWQQDWLINADLIVTNPGIALASPQLKPAIDKGIKIV
GDIELFAWAVNAPVIAITGSNGKSTVTDLTGEMAKAAGVKTAVGGNIGFAALDLLEQDAE
LYVLELSSFQLETTSTLKLKAAAFLNLSEDHMDRYQGMADYRQAKLRIFEHAEVCIVNRD
DKQTYPDVEKTLKSFGFDQGDYGCIEKDGIEYLAKNTVPLLAANELGLVGKHNIANSLVA
IALLDAAGINLDATLDTLRTYNGLTHRCQVVADNNGIRWVNDSKATNVASTLAALSGLQL
EGKLHLLVGGVGKGADFSELSPALHDLNLMMYCFGEDGDQFVSLDPRSLLCETMNEAIAT
LYPTLNKGDMVMLSPACASFDQYANFMARGDAFTQLAKQYSIES
Download sequence
Identical sequences YP_205586.1.56684 gi|59712810|ref|YP_205586.1| 312309.VF_2203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]