SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712813|ref|YP_205589.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712813|ref|YP_205589.1|
Domain Number 1 Region: 105-334
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.2e-71
Family MurCDEF 0.000000808
Further Details:      
 
Domain Number 2 Region: 337-489
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 9.03e-49
Family MurCDEF C-terminal domain 0.00000571
Further Details:      
 
Domain Number 3 Region: 2-101
Classification Level Classification E-value
Superfamily MurE/MurF N-terminal domain 4.71e-26
Family MurE/MurF N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712813|ref|YP_205589.1|
Sequence length 493
Comment UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate ligase [Vibrio fischeri ES114]
Sequence
MMQLSELLLPWCDLNQSVAISSMTLDSRQVSPGCLFVAIKGHAVDGRQFISSAIEQGAVA
VIADADKENIAGTVKVIDNAIVVYIDSLYTQLSAIAGAFYQADKRNMQLVGITGTNGKTT
ISQIIAQWTTLLEQPAAVMGTTGNGLLSDLKPALNTTGSPIEIQQTLTELENIGAKLTAL
EVSSHGLVQGRVNALSFDAAVFTNLSRDHLDYHGDMANYAEAKKLLFTSHRPKNSIINGD
DQVGCQWLKEMPHAVAVSLNEENISFHSGKKVFATSVVYSTEGIKLSISSDWGNVAFSVP
LIGAFNASNILVAFAALLSLGYDIQALAQTASQLNAVIGRMELFATDNKAKVVVDYAHTP
DALDKALQALRVHCEGKLWCIFGCGGDRDTGKRPIMASIVEQQADAIILSDDNPRSEEPS
LITDDMLVGLKNAESAHVIHDRFEACQFALSQANENDIILLAGKGHEDYQVLADKTVHYS
DRETAQTLLGLQS
Download sequence
Identical sequences Q5E2P5
312309.VF_2206 gi|59712813|ref|YP_205589.1| YP_205589.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]