SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712823|ref|YP_205599.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712823|ref|YP_205599.1|
Domain Number 1 Region: 82-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.98e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 8-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.57e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712823|ref|YP_205599.1|
Sequence length 211
Comment stringent starvation protein A [Vibrio fischeri ES114]
Sequence
MAVAANKRSVMTLFSDASDMYSHQVRIVLAEKGVSVEVELVDPSNLPAELVELNPYKTVP
TLVDRELALYNSNIIMEYLDERFPHPPLMPVYPVARGNSRLMMHRVETNWYSLAEKVVKG
SFEESEAARNKLRNDLLMLGPIFAEYTYFMSDEFSLVDCYLAPLLWRLPSMGIELSGPGA
KELKVYMNRVFERDSFLASLTEAERELRLTN
Download sequence
Identical sequences A0A1B9PF04 B5FB50 Q5E2N5
gi|59712823|ref|YP_205599.1| gi|197335755|ref|YP_002157012.1| 312309.VF_2216 388396.VFMJ11_2328 WP_005420949.1.100783 WP_005420949.1.102040 WP_005420949.1.11820 WP_005420949.1.198 WP_005420949.1.21686 WP_005420949.1.21775 WP_005420949.1.21836 WP_005420949.1.23113 WP_005420949.1.31530 WP_005420949.1.32349 WP_005420949.1.34024 WP_005420949.1.3463 WP_005420949.1.34959 WP_005420949.1.44395 WP_005420949.1.47877 WP_005420949.1.62330 WP_005420949.1.66091 WP_005420949.1.76599 WP_005420949.1.76652 WP_005420949.1.77059 WP_005420949.1.80135 WP_005420949.1.81434 WP_005420949.1.82276 WP_005420949.1.85856 WP_005420949.1.93430 WP_005420949.1.94618 WP_005420949.1.97281 YP_205599.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]