SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712825|ref|YP_205601.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712825|ref|YP_205601.1|
Domain Number 1 Region: 6-221,249-297
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.04e-92
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000285
Further Details:      
 
Domain Number 2 Region: 298-409
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 7.19e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712825|ref|YP_205601.1|
Sequence length 422
Comment cytochrome b [Vibrio fischeri ES114]
Sequence
MQPLLDWVEKRLPAMNAYKKHLSEYPMPKNFNFWYFFGSLAMLVLVNQIVTGIWLTMNYV
PSGEGAFASVEYIMRDVDYGWLLRYMHSTGASAFFVVVYLHMFRGLIYGSYQKPRELLWL
FGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPIIGDDLTLWIRGDYVISGAT
LNRFFALHVIALPIVLLLLVVLHILALHEVGSNNPDGIETKLPKAKDDKGEHKTQFKFHE
YYTSKYNIIDSVPFHPYGTVKDMIGVAGFLFFFCYVLFFNPEMGGYFLEPPNFEAANPLK
TPEHIAPVWYFTPFYAILRAVPDKLLGVVAMGASIVVLFLLPWLDRCKVRSYRYRSKLHL
LNIIQFTISFIALGVLGALPATPTYTLLAQIFSLMYFMFFVILFIYSKNEVTKPLPERVT
FK
Download sequence
Identical sequences Q5E2N3
WP_011262643.1.76652 YP_205601.1.56684 gi|59712825|ref|YP_205601.1| 312309.VF_2218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]