SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712832|ref|YP_205608.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712832|ref|YP_205608.1|
Domain Number 1 Region: 10-58,89-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.22e-64
Family Prokaryotic proteases 0.0000005
Further Details:      
 
Domain Number 2 Region: 233-350
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-23
Family HtrA-like serine proteases 0.00043
Further Details:      
 
Domain Number 3 Region: 380-454
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000289
Family HtrA-like serine proteases 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59712832|ref|YP_205608.1|
Sequence length 455
Comment serine endoprotease DegP (protease Do), periplasmic [Vibrio fischeri ES114]
Sequence
MKKPLLVLGALTLSISAILTPIQSQAALPIAVDSQQLPSLAPMLEKITPAVVSIAVEGTQ
VSKRHIPEQFRFFFGPDFPSEQVQEQPFRGLGSGVIVDAKKGYIVTNHHVINNAEKILVQ
LHDGREYTAELIGSDELSDIALLKLEEAKNLTEIKLADSDNLRVGDFSVAIGNPFGLGQT
VTSGIISALGRSGLNLDNFENFIQTDAAINSGNSGGALVNLNGDLIGINTAILGPNGGNV
GIGFAIPSNMVRNLSEQILEFGHVKRGILGVQGGELTPELAEAFDYETNHGAFVSQVVPD
SAADKAGIQAGDILISINGKKIQTFGELRAKVATLGAGKKVTLGLIRDGKEKTVTATLKE
AEQIKAQAENLHNGLKGAELQNTTQSDPVKGVKISNVEKTSMAQRYGLQKDDIIIGVNRK
PVKNLQQFRKLLESKPPVLALNIQRGEHTLYLVIK
Download sequence
Identical sequences Q5E2M6
gi|59712832|ref|YP_205608.1| WP_011262646.1.76652 YP_205608.1.56684 312309.VF_2225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]