SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712833|ref|YP_205609.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712833|ref|YP_205609.1|
Domain Number 1 Region: 47-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-59
Family Prokaryotic proteases 0.000000582
Further Details:      
 
Domain Number 2 Region: 240-347
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family HtrA-like serine proteases 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712833|ref|YP_205609.1|
Sequence length 354
Comment serine endoprotease DegS, periplasmic [Vibrio fischeri ES114]
Sequence
MLSFLLRSAMIGIATAAILLFAFPNLRSNITLDQGAIERTSQNSKQISFNYAVRRAAPAV
VNIYSRKYNDNDRLRLDTEGLGSGVIVSDKGYIITNYHVVADADQVIVALQDGRLFNSQL
IGKDKRTDLAVLQIKDANLPVIPLNPNYQADIGDVVLAIGNPYNLGQTTTFGIISATGRA
ALSADGTQGLIQTDAAINRGNSGGALVNTRGELVGINTASFQQATELETYGISFAIPYAL
ADKIMRRLIADGQVIRGYIGIDGRDINPAMARLMNADNINGILVLGVSPNSPAEKAGIIT
QDIITSIDGKSVTNRQSVIDIVTELRPGTEVDVDVIRKGKTETIKVTIEEDPNN
Download sequence
Identical sequences Q5E2M5
312309.VF_2226 WP_011262647.1.76652 YP_205609.1.56684 gi|59712833|ref|YP_205609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]