SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712914|ref|YP_205690.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712914|ref|YP_205690.1|
Domain Number 1 Region: 3-176,301-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.14e-55
Family Bacterial dinuclear zinc exopeptidases 0.0011
Further Details:      
 
Domain Number 2 Region: 180-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.64e-22
Family Bacterial exopeptidase dimerisation domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59712914|ref|YP_205690.1|
Sequence length 378
Comment acetylornithine deacetylase [Vibrio fischeri ES114]
Sequence
MKFPEFKDYYQQLISTSSISSTDSSWDEGNAEVINKLAQWCEDLGCEVEIEEIEKGKLNL
LAKLGSGEGGLLLAGHTDTVPYDEGRWNYEPHALTEANDRFYGLGTADMKGFFAFILEAI
KNINWKDQSKPLYILATCDEETTMLGARHFASNTKIQPDYCIIGEPTSLKPIRGHKGHVA
NAIRVTGKSGHSSDPAHGVNALEIMNEIMFALMTLKNKLVKEYHNPGFSIPYPTLNLGHI
HGGDSPNRICGCCELHYDVRPLPGISLDGLDNMLRDALKEIEAKWPGRIDITPLHEPIPG
YECSADSPIVTSTADICGQDVETVNYCTEAPFLQDLCPTLVLGPGSIEQAHQPDEYLAFS
FIDPTISILSKLMYKHCF
Download sequence
Identical sequences Q5E2E4
gi|59712914|ref|YP_205690.1| WP_011262714.1.76652 YP_205690.1.56684 312309.VF_2307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]