SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712918|ref|YP_205694.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712918|ref|YP_205694.1|
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.32e-29
Family Ribosomal protein S18 0.0000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712918|ref|YP_205694.1|
Sequence length 75
Comment 30S ribosomal protein S18 [Vibrio fischeri ES114]
Sequence
MARFFRRRKFCRFTAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTRAKYQRQLARAIK
RSRYLALLPYTDKHL
Download sequence
Identical sequences A0A090KFI2 A0A0B7JBB3 A0A0H3SVG4 A0A178KQC8 A0A1A6U536 A0A1B9P2X5 A0A1B9P7P8 A0A1B9PFC8 A0A1T4THJ0 A0A1T5I3M0 A0A1Y6MMA7 A0A1Y6MMV6 B5FBQ1 B6EMP4 Q5E2E0
gi|59712918|ref|YP_205694.1| gi|209696170|ref|YP_002264100.1| 312309.VF_2311 316275.VSAL_I2764 388396.VFMJ11_2423 WP_005421136.1.100783 WP_005421136.1.101673 WP_005421136.1.102040 WP_005421136.1.11820 WP_005421136.1.18042 WP_005421136.1.1820 WP_005421136.1.198 WP_005421136.1.20244 WP_005421136.1.21686 WP_005421136.1.21775 WP_005421136.1.21836 WP_005421136.1.23113 WP_005421136.1.25321 WP_005421136.1.31530 WP_005421136.1.32349 WP_005421136.1.33597 WP_005421136.1.33699 WP_005421136.1.34024 WP_005421136.1.3463 WP_005421136.1.34959 WP_005421136.1.35969 WP_005421136.1.44395 WP_005421136.1.47877 WP_005421136.1.50441 WP_005421136.1.52077 WP_005421136.1.54541 WP_005421136.1.59820 WP_005421136.1.60517 WP_005421136.1.62330 WP_005421136.1.64271 WP_005421136.1.65751 WP_005421136.1.66091 WP_005421136.1.6728 WP_005421136.1.67757 WP_005421136.1.70793 WP_005421136.1.73213 WP_005421136.1.75476 WP_005421136.1.76599 WP_005421136.1.76652 WP_005421136.1.77059 WP_005421136.1.77666 WP_005421136.1.79258 WP_005421136.1.80135 WP_005421136.1.81434 WP_005421136.1.82276 WP_005421136.1.82896 WP_005421136.1.8410 WP_005421136.1.84580 WP_005421136.1.85856 WP_005421136.1.92505 WP_005421136.1.93330 WP_005421136.1.93430 WP_005421136.1.94618 WP_005421136.1.94693 WP_005421136.1.95439 WP_005421136.1.9550 WP_005421136.1.96195 WP_005421136.1.97281 WP_005421136.1.98345 WP_005421136.1.98593 YP_205694.1.56684 gi|197335451|ref|YP_002157106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]