SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712958|ref|YP_205734.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712958|ref|YP_205734.1|
Domain Number 1 Region: 170-379
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 5.23e-48
Family Peptidoglycan hydrolase LytM 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712958|ref|YP_205734.1|
Sequence length 381
Comment protease with a role in cell division [Vibrio fischeri ES114]
Sequence
MNISLLNNSFFCRRLATTALVCLAFSSPILVHASDAELKGMKQEISRQNTVLSKQKKELS
SLQNSLKKHEVSIANASKKIRNAEQELTTLKSSISSLKQQQSELTQQQIGQTEILKDLLV
NYYLTSRNNQLSNVLSGDDVTKMDRMTQYAQRISEARVGAISQLEFTNMQLEEKEADLLE
KQQRQSELLAQYKKEKVTLQTSQNKRKKTVSSIRKRITNESSYLNELQQNEKRLKTAIAK
AKAKNNVPMDGIGRQKGRLPWPISNPKTLHSFGTKQTGQLTWKGMVLAGDYGTPVKAVYS
GKVVFADWLRGYGLMVLIDHGKGDMTLYGYNQSLMKKEGDKVRAGETIAVVGDSGGQDRP
SLYFEIRRNSKAQNPRSWLRR
Download sequence
Identical sequences Q5E2A0
WP_011262746.1.21775 WP_011262746.1.21836 WP_011262746.1.23113 WP_011262746.1.76652 WP_011262746.1.80135 YP_205734.1.56684 gi|59712958|ref|YP_205734.1| 312309.VF_2351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]