SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713082|ref|YP_205858.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713082|ref|YP_205858.1|
Domain Number 1 Region: 206-300
Classification Level Classification E-value
Superfamily PDZ domain-like 3.7e-18
Family EpsC C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59713082|ref|YP_205858.1|
Sequence length 302
Comment general secretion pathway protein C [Vibrio fischeri ES114]
Sequence
MITNMKIEKISQYWSIYQSTIAKSLTVILVAWFAWICGSLFWSMLAPQTSVSKWTPKTVA
VAVSQGKQGKDSLSELLNSQVFGRFNAEQKIDQPKAVEVKDAPKTRLNLTLSGVVASSEP
SLSLAVIANRGKQNTYGINETIDGTRASVKAISADRIIISNNGRDETLMLEGVEYTKIST
ERNITGSSGTVLGNNRQNSNQDELDKIRKEMAQNPQSVLKYIRLSQVNENGKIKGYRVNP
GKDRKLFDSVGLKPGDIATSLNGVDLTDPAAMSSLWKNMSEMTELNLTVLRNGQLYDIFV
GL
Download sequence
Identical sequences Q5E1X6
312309.VF_2475 WP_011262834.1.76652 YP_205858.1.56684 gi|59713082|ref|YP_205858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]