SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713172|ref|YP_205948.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713172|ref|YP_205948.1|
Domain Number 1 Region: 2-288
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.47e-97
Family ATP synthase (F1-ATPase), gamma subunit 0.0000000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59713172|ref|YP_205948.1|
Sequence length 288
Comment ATP synthase F0F1 subunit gamma [Vibrio fischeri ES114]
Sequence
MAGAKEIRNKIGSVKSTQKITKAMEMVAASKMRRSQESMEASRPYADTMRKVIGHLALGN
LEYRHPYLEEREAKRVGYIVISSDRGLCGGLNINLFKKVMTEMKTWSEDGVEIDLAVIGS
KATAFFNSYGGNVVAQNSGLGDHPSLEELIGTVGVMLKKYDEGQLDRLYVVNNKFINTMV
QEPAIEQLLPLPKSEDEAMQRTHAWDYIYEPEPKPLLDALLVRYVESQVYQGVVENLACE
HVARMIAMKAATDNAGDIIDELQLVYNKARQAAITQELSEIVSGASAV
Download sequence
Identical sequences Q5E1N6
312309.VF_2565 WP_011262900.1.76652 YP_205948.1.56684 gi|59713172|ref|YP_205948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]