SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713202|ref|YP_205977.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713202|ref|YP_205977.1|
Domain Number 1 Region: 4-172
Classification Level Classification E-value
Superfamily PRTase-like 2.1e-35
Family Phosphoribosyltransferases (PRTases) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59713202|ref|YP_205977.1|
Sequence length 174
Comment hypoxanthine-guanine phosphoribosyltransferase [Vibrio fischeri ES114]
Sequence
MNNKHIGELVLSTEQIKAGVRLVADKLNQQFAGEEIIIVSMVPGGILFSADLVRELTLDI
KMDYVSCPHTPGDSNNSSNIVYHQNIPIKEKHVVLVDDAIESGGTMKRVARYMAEEFGVK
SLSIATLFVKPGRVDIPYPQYFAYEMENDDMLVGYGLPWQDKHRNIPFVSKLIK
Download sequence
Identical sequences Q5E1K7
gi|59713202|ref|YP_205977.1| 312309.VF_A0019 WP_011262923.1.198 WP_011262923.1.21686 WP_011262923.1.21775 WP_011262923.1.3463 WP_011262923.1.76652 WP_011262923.1.85856 WP_011262923.1.93430 YP_205977.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]