SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713254|ref|YP_206029.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713254|ref|YP_206029.1|
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.67e-48
Family H-NOX domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59713254|ref|YP_206029.1|
Sequence length 177
Comment heme nitric oxide and/or oxygen binding protein HNOX [Vibrio fischeri ES114]
Sequence
MKGIIFSEFLELVEDKFGLEVCQQMLDENNDEGAYTAVGTYDHKHLVKLIISLSKVTGVS
IEDLQQVYGKSVFLTLFQSMPELDGQALNTFEFIKQVESYIHLEVKKLYAEANPPRFKFI
SSTETEMVMDYISARCFSHVCFGLILGCAEHFNEIIDIQMTPVLDDGSQVRFTLTKS
Download sequence
Identical sequences Q5E1F5
WP_011262973.1.76652 YP_206029.1.56684 312309.VF_A0071 gi|59713254|ref|YP_206029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]