SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713343|ref|YP_206118.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713343|ref|YP_206118.1|
Domain Number 1 Region: 354-667
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 2.75e-65
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000509
Further Details:      
 
Domain Number 2 Region: 23-338
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 3.79e-65
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59713343|ref|YP_206118.1|
Sequence length 667
Comment iron-hydroxamate transporter permease subunit [Vibrio fischeri ES114]
Sequence
MRVSSVLGKPKIGSSRTGLNIGIIVLMCIVLLSLLQWTAPYSQGIDLLWKTVFHYDSSDY
QQLITYLTYLPRLSIAVLSGFGLAIAGCVMQFVLRNPIASPTTLGVAAGAELGMVLGILF
LPVSSSISGFIPAFLGGAFATGLVFLLSVKRGFSPVHMVLAGMVVSLFFGSLNTMLLLLN
EQQLTSVFVWGAGTLNQNDWSSVSRLIPLITFPVITILLLARPLSALQLGDHVASSIGIN
IKQIKVISLTLAIFITAAVVSEVGLIGFVGIVAPAIARMCGARGLPTQILMSGSIGSVML
LFADLIIQPFSGVGGELLPTGAMTALLGAPFLLWLLNRQQLQSEMKVRETSQIVYRVRSL
RFVIVPLSLLIVVLFIGAALLGKGQLGWAVTFDISIIELRIPRVFVAFLAGVGLAIAGTV
IQRVSMNPMASPEILGISSGAALALVLGAVSGVAINRHEQMLLGTLGALIVTFVIWIMGR
KHHFAPTQMLLTGIALSAGLDAFLRIALSSGQDNVKALLTWLSGSTYLVSMNDVYLLAVG
VSLFFIFAMKSHRWLDLMGLGDTVASSVGLCCRRVRLFLLLFVAALTTLCTIIIGPLSFI
GLLAPHMARSLHQYQASHQLIAASLLGGCLMILADWIGRVMWFPWQFPAGLLASLIGGIY
FLYLMRK
Download sequence
Identical sequences Q5E166
gi|59713343|ref|YP_206118.1| WP_011263058.1.76652 YP_206118.1.56684 312309.VF_A0160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]