SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713350|ref|YP_206125.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713350|ref|YP_206125.1|
Domain Number 1 Region: 88-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000222
Family NfeD domain-like 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|59713350|ref|YP_206125.1|
Domain Number - Region: 27-89
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00112
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59713350|ref|YP_206125.1|
Sequence length 150
Comment hypothetical protein VF_A0167 [Vibrio fischeri ES114]
Sequence
MEFFEQMNHWHWLTLGLLLLAGELLGTAGYFLWIGLSAVAVGALYAVIPLSWQMQWISFA
VFSLFTTWLWWRYQHKKDISSDAKRALNQKDKQLIGQTSRLEEDIHAGSCRIVLGDTTWS
AKSAVDIEKGTLVRVVSVDGIILTIEPVKK
Download sequence
Identical sequences Q5E159
WP_011263065.1.11820 WP_011263065.1.21836 WP_011263065.1.23113 WP_011263065.1.76652 WP_011263065.1.80135 YP_206125.1.56684 gi|59713350|ref|YP_206125.1| 312309.VF_A0167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]