SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59713849|ref|YP_206624.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713849|ref|YP_206624.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 7.9e-33
Family PaaI/YdiI-like 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59713849|ref|YP_206624.1|
Sequence length 141
Comment hypothetical protein VF_A0666 [Vibrio fischeri ES114]
Sequence
MSIWKREMDLTVLNTTSRNTLMEALSIEYCAYDDNSITASMPVTSTVHQPLGMLHGGASV
ALAESVASIAANWCVDESKYCVGLEINANHIRAVREGTVFATAKPLHLGATTHVWVIDIK
DQRDRLVCTSRFTVAVMKKKK
Download sequence
Identical sequences A0A1B9P688 B5EUE3 Q5DZR0
312309.VF_A0666 388396.VFMJ11_A0762 gi|59713849|ref|YP_206624.1| WP_005422946.1.102040 WP_005422946.1.11820 WP_005422946.1.198 WP_005422946.1.21686 WP_005422946.1.21775 WP_005422946.1.31530 WP_005422946.1.32349 WP_005422946.1.34024 WP_005422946.1.3463 WP_005422946.1.34959 WP_005422946.1.44395 WP_005422946.1.62330 WP_005422946.1.66091 WP_005422946.1.76599 WP_005422946.1.76652 WP_005422946.1.77059 WP_005422946.1.80135 WP_005422946.1.82276 WP_005422946.1.85856 WP_005422946.1.93430 WP_005422946.1.94618 WP_005422946.1.97281 YP_206624.1.56684 gi|197337423|ref|YP_002158311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]