SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59713929|ref|YP_206704.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713929|ref|YP_206704.1|
Domain Number 1 Region: 19-216
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.11e-40
Family UbiE/COQ5-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59713929|ref|YP_206704.1|
Sequence length 273
Comment biotin biosynthesis protein BioC [Vibrio fischeri ES114]
Sequence
MVNPAVAIDMFNSTSNKEKQAIQAAFSKAAHTYDRSAEFQRQVADTLLSYLPTDLTGLRI
LDVGCGTGYCCEALLKRGACVVAFDLSSVMLEKAKERCGDHNITYIQGDAEDLPFMDDEF
DGVVSSLALQWCQDLSVPLREMKRISHNKSKVIFSTLLDGSLFELKKAWSKVDLYQHVND
FITPSMVKIALAQSECNNFTLHCTSVEMTYSSALALMKDLKGIGATHLPNGRSSGLLSKE
KLLAVEEAYQLFRSELNHLPATYQVGYGVISND
Download sequence
Identical sequences Q5DZI0
WP_011263573.1.76652 YP_206704.1.56684 gi|59713929|ref|YP_206704.1| 312309.VF_A0746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]