SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59713964|ref|YP_206739.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59713964|ref|YP_206739.1|
Domain Number 1 Region: 358-665
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 2.09e-61
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000435
Further Details:      
 
Domain Number 2 Region: 10-333
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 5.89e-56
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59713964|ref|YP_206739.1|
Sequence length 671
Comment iron-hydroxamate transporter permease subunit [Vibrio fischeri ES114]
Sequence
MPNSFITTPIRYLLAFISLFLVVWMSFQWNATLSLPQQIDAILQVISNPSSLDDFDKIIF
IESQLPRLVMAILIGGMLGLVGSLMQQLTQNSLVSPMTLGAASGAWLALVVMNVWFADYV
ADYASIAALFGALITFALVVAIAGVNNLSGLPIVLSGMAVNIFLGAVATAIILLNDQYAK
NLFIWGAGDLAQNGWEQVQWLLPKLSVSLLIFVFAPRILALLRLGNVGAAARGLNVIPAF
FGLFALGLWLVASSITTVGVISFIGLLAPNIARHLGARTPRDELFFSLLLGVTLLVGTDL
LASIISQYTTDIVPSGTAAALIGAPALIWFTRRTMSSQDQLSISLPKGKSILPIWLIPSL
GFGLIVVLFLAVIVTKDSTQTLHPWTVLIPSEFSWELKWPRLLTALSAGSGLAVAGVLLQ
RLIYNPLASPDILGISAGATFALIGGSVFLGFNIFEAAPLVAFCGSLTVLVLLLILGKRH
GYAPSMLILTGIALTALIDALVQFSLAKGNEDSYILLNWLAGSTYRVSAQSALILFVCIV
LLLMFALLTHRWLTLISAGRLFAQARGLSVTKSFIALLICVALLCGAVTATMGPVAFIGL
LAPHMAVILGAKKAKEQIIVAALIGALLMIIADWFGQHILFPSQIAAGTLVSVIGGLYFI
GLLIKGQRSKY
Download sequence
Identical sequences Q5DZE5
gi|59713964|ref|YP_206739.1| WP_011263606.1.76652 YP_206739.1.56684 312309.VF_A0781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]